Description / VEGFR-3/FLT-4, soluble
Recombinant human soluble Vascular Endothelial Growth Factor Receptor-3 (sVEGFR-3/FLT-4) was fused with a carboxy-terminal 6X histidine-tag. The recombinant mature sVEGFR-3/FLT-4 is a glycosylated monomeric protein. The sVEGFR-3/FLT-4 monomers have a mass of approximately 120 kDa. The soluble receptor protein consists of all 7 extracellular domains (Met1-Glu774). All three VEGF receptors belong to the class III subfamily of receptor tyrosine kinases (RTKs) characterised by the seven immunoglobulin-like loops in the extracellular domain. The expression of VEGFR-1 to -3 is almost exclusively restricted to hematopoietic precursor cells, vascular and lymphatic endothelial cells and to the monocyte/macrophage lineage. They play key roles in vasculogenesis, hematopoiesis, angiogenesis and lymphangiogenesis. The FLT-4 cDNA encodes a 1298 amino acid (aa) residue precursor protein with a 23 aa residue signal peptide. Mature VEGFR-3/FLT-4 is composed of a 751 aa residue extracellular domain, a 22 aa transmembrane domain and a 482aa residue cytoplasmic domain. Both VEGF family members VEGF-C and VEGF-D have been shown to bind and activate VEGFR-3/FLT-4. The Flt-4 gene is widely expressed in the early embryo but becomes restricted to the lymphatic endothelial a latter stages of development. It is important for lymphangiogenesis.
More Information
Size | 50 µg |
---|---|
Source | Insect cells |
Biological Activity | Measured by its ability to bind recombinant rat VEGF-C in a functional solid phase binding assay. Immobilized recombinant human sVEGFR-3/FLT-4 at 5µg/ml can bind recombinant rat VEGF-C in a linear range of 8-500ng/ml |
N Terminal Sequence | DPSGYSMTPPTLNITEESHV |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 761 |
Molecular Weight | 110 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | DPSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAER |
Reconstitution | The lyophilized sVEGFR-3/FLT-4 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than100 µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sVEGFR-3/FLT-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
Synonyms | soluble vascular endothelial growth factor receptor-3; FLT4; PCL; LMPH1A; fms-related tyrosine kinase 4 |
Uniprot ID | P35916 |
Protein RefSeq | NP_002011 |
mRNA RefSeq | NM_002020 |