mouse VEGFR-2/Flk-1 (native), soluble protein Mouse 20 µg
Description / mouse VEGFR-2/Flk-1 (native), soluble protein
More Information
Size | 20 µg |
---|---|
Source | Insect cells |
Biological Activity | Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells. |
N Terminal Sequence | ASVGLPGDFL |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 654 |
Molecular Weight | 105 kDa |
Species Reactivity | Mouse |
Formulation | lyophilized |
Buffer | 25 mM MES, 100 mM NaCl; pH 5.5 |
Protein Sequence | ASVGLTGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLDWLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVYVRDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSAGEKLVLNCTARTELNVGLDFTWHSPPSKSHHKKI |
Reconstitution | The lyophilized mouse sFlk-1 is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100µg/ml. |
Stability and Storage | The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4°C not longer than 2 days. |
Synonyms | soluble vascular endothelial growth factor receptor-2; Kdr; Flk1; Ly73; Flk-1; VEGF receptor 2; VEGFR-2; sVEGFR-2 |
Uniprot ID | P35918 |
Protein RefSeq | ACJ66293.1 |
mRNA RefSeq | EU884114 |