human VEGFR-1/Flt-1 (native), soluble protein Human 20 µg
Description / human VEGFR-1/Flt-1 (native), soluble protein
More Information
Size | 20 µg |
---|---|
Source | Insect cells |
Biological Activity | The activity of sVEGFR-1 was determined by its ability to inhibit the VEGF-A-induced proliferation of HUVECs. |
N Terminal Sequence | SKLKD |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 661 |
Molecular Weight | 96.0 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRR |
Reconstitution | The lyophilized sVEGFR-1 is soluble in water and most aqueous buffers. The lyophilized sVEGFR-1 should be reconstituted in PBS to a concentration not lower than 100µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sVEGFR-1 should be stored in working aliquots at -70°C. Avoid repeated freeze-thaw cycles! |
Synonyms | soluble vascular endothelial growth factor receptor-1; soluble FLT1; soluble VEGFR-1 |
Uniprot ID | P17948 |
Protein RefSeq | NP_001153392 |
mRNA RefSeq | NM_001159920 |