human VEGFR-1/Flt-1 (D5), soluble protein Human 20 µg

In stock

Cat-Nr.
S01-012
Size
20 µg
  €268.00

Description / human VEGFR-1/Flt-1 (D5), soluble protein

Recombinat human soluble Vascular Endothelial Growth Factor Receptor-1 domain D1-5 (sVEGFR-1(D5)) is a 70 kDa protein containing amino acid residues. The baculovirus generated, recombinant human sVEGFR-1 is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein contains only the first 5 extracellular domains, which contain all the information necessary for high affinity ligand binding. The receptor monomers have a mass of approximately 70 kDa. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVE supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.

More Information

Size 20 µg
Source Insect cells
Biological Activity The activity of sVEGFR-1(D5) was determined by its ability to inhibit the VEGF-A-induced proliferation of HUVECs.
N Terminal Sequence SKLKD
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 536
Molecular Weight 70.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRR
Reconstitution The lyophilized human sVEGFR-1(D5) is soluble in water and most aqueous buffers. The lyophilized powder should be reconstituted in water to a concentration not lower than 100µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sVEGFR-1(D5) should be stored in working aliquots at -70°C.
Synonyms soluble vascular endothelial growth factor receptor-1; soluble FLT1; soluble VEGFR-1
Uniprot ID P17948
Protein RefSeq NP_001153392
mRNA RefSeq NM_001159920

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges