Description / mouse TIE-2, soluble protein
More Information
Size | 50 µg |
---|---|
Source | Insect cells |
Biological Activity | Testing under progress. |
N Terminal Sequence | AMDLILINSL |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 712 |
Species Reactivity | Mouse |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | AMDLILINSLPLVSDAETLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCP |
Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-2-His should be stored in working aliquots at -20°C. |
Synonyms | Angiopoietin-1 receptor; Endothelial tyrosine kinase; HYK; STK1; Tunica interna endothelial cell kinase; Tyrosine kinase with Ig and EGF homology domains-2; Tyrosine-protein kinase receptor TEK; Tyrosine-protein kinase receptor TIE-2; p140 TEK; CD202b; Te |
Uniprot ID | Q02858 |
Protein RefSeq | NP_038718.2 |
mRNA RefSeq | NM_013690.2 |