Description / human TIE-2, soluble protein
Recombinant human soluble TIE-2/TEK was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Thr19-Lys745). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/TEK comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-2 cDNA encodes a 1124 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Two ligands, angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2), which bind TIE-2 with high affinity have been identified. Ang2 has been reported to act as an antagonist for Ang1. Mice engineered to overexpress Ang2 or to lack Ang1 or TIE-2 display similar angiogenic defects.
More Information
Size | 10 µg |
---|---|
Source | Insect cells |
Biological Activity | Measured by its ability to bind to immobilized recombinant Ang-2 in a functional ELISA. |
N Terminal Sequence | AMDLILINSL |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 731 |
Molecular Weight | 95.0 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSY |
Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-2-His should be stored in working aliquots at -20°C. |
Synonyms | TEK; TIE2; VMCM; TIE-2; VMCM1; CD202B |
Uniprot ID | Q02763 |
Protein RefSeq | NP_000450.2 |
mRNA RefSeq | NM_000459.3 |