Description / TIE-2/Fc Chimera, soluble
Recombinant human soluble TIE-2/Tek was fused with the Fc part of human IgG1. The recombinant mature sTIE-2/Fc is a disulfide-linked homodimeric protein. The sTIE-2/Fc monomers have a mass of approximately 125 kDa. The soluble receptor protein consists of the full extracellular domain (Met1-Val730). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-2 cDNA encodes a 1124 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Two ligands, angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2), which bind TIE-2 with high affinity have been identified. Ang2 has been reported to act as an antagonist for Ang1. Mice engineered to overexpress Ang2 or to lack Ang1 or TIE-2 display similar angiogenic defects. The recombinant mature TIE-2-Fc is a disulfide-linked homodimeric protein. Human TIE-2-Fc monomer has a calculated molecular mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 125 kDa protein in SDS-PAGE under reducing conditions.
More Information
Size | 100 µg |
---|---|
Source | Insect cells |
Biological Activity | Testing under progress. |
N Terminal Sequence | AMDLILINSL |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 938 |
Molecular Weight | 250.0 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSY |
Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-2/Fc should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
Synonyms | TEK; TIE2; VMCM; TIE-2; VMCM1; CD202B |
Uniprot ID | Q02763 |
Protein RefSeq | NP_000450.2 |
mRNA RefSeq | NM_000459.3 |