Description / mouse TIE-1, soluble protein
More Information
Size | 50 µg |
---|---|
Source | Insect cells |
Biological Activity | Data not available. |
N Terminal Sequence | SVDLTLLANL |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 735 |
Species Reactivity | Mouse |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | SVDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLLEKDDRIVRTFPPGQPLYLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNSPGAHLFPDKVTHTVNKGDTAVLSAHVHKEKQTDVIWKNNGSYFNTLDWQEADDGRFQLQLQNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTAGC |
Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-1-His is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-1-His should be stored in working aliquots at -20°C. |
Synonyms | Tie1; TIE; tie-1; D430008P04Rik |
Uniprot ID | Q06806 |
Protein RefSeq | NP_035717.2 |
mRNA RefSeq | NM_011587.2 |