Description / mouse SF-20 protein
Mouse SF20 is a bone marrow stroma-derived growth factor. SF20 is expressed in the bone marrow, spleen stroma cells, resting mononuclear cells, resting CD8+ and CD19+ cells and activated CD8+ T cells. SF20 has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Among SF20’s biological activities is stimulation of the proliferation of FDCP2 cells (a mouse factor-dependent hemopoietic cell line) and mouse lymphoid cells.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Data not available. |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 143 |
| Molecular Weight | 15.8 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Protein Sequence | MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL |
| Synonyms | C19orf10; IL25; IL27; SF20; IL27w; R33729_1; EUROIMAGE1875335 |
| Uniprot ID | Q9CPT4 |
| Protein RefSeq | NP_543027.1 |
| mRNA RefSeq | NM_080837.2 |