Human CD34, soluble
Slide this table
Cat-Nr. | S01-069 |
Size | 20 µg |
Price | 180 € |
Source | E. coli |
Label | His-Tag |
Formulation | lyophilized |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 267 |
Molecular Weight | 28.6 kDa |
N Terminal Sequence | SLDNN |
Biological Activity | Data not available. |
Species Reactivity | Human |
Synonyms | CD34 |
Description | CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein. |
Protein Sequence | SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLEHHHHHH |
Uniprot ID | P28906 |
Protein RefSeq | NP_001764.1 |
mRNA RefSeq | NM_001773.2 |
Figures
![](/fileadmin/user_upload/products/CD34/S01-069_Coom.jpg)
SDS-PAGE analysis of recombinant human soluble CD34 produced in E. coli. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.
All prices plus VAT + possible delivery charges