Rabbit Growth Hormone Receptor (hGH binding protein), soluble
Slide this table
| Cat-Nr. | 500-016 |
| Size | 100 µg |
| Price | 510 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 248 |
| Molecular Weight | 28.0 kDa |
| N Terminal Sequence | APSGS |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | hGHBP is fully biologically active as evidenced by its ability of forming 2:1 complex with non-primate GHs. |
| Reconstitution | It is recommended to reconstitute the lyophilized rbGHBP in sterile 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Description | Recombinant rbGHBP, one polypeptide chain containing 248 amino acids and having a molecular mass of ~ 28 kDa, Rabbit GHBP was purified by proprietary chromatographic techniques, (see Sakal et al. Prep Biochem Biotechnol. 30:107-23, 2000). |
| Protein Sequence | AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRF |
| Uniprot ID | P19941 |
| Protein RefSeq | NP_001076105.1 |
| mRNA RefSeq | NM_001082636.1 |
All prices plus VAT + possible delivery charges