Mouse PlGF
Slide this table
| Cat-Nr. | M30-019 |
| Size | 5 µg |
| Price | 180 € |
| Source | Insect cells |
| Formulation | lyophilized |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 135/132 |
| Molecular Weight | ~40 kDa |
| N Terminal Sequence | ALSAGNNSTE and AGNNSTE |
| Biological Activity | Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL. |
| Species Reactivity | Mouse |
| Buffer | 25 mM Tris, 75 mM NaCl pH 8.5 |
| Stabilizer/Carrier | BSA (50-fold) |
| Reconstitution | Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use. |
| Stability and Storage | The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. |
| Synonyms | Pgf; PlGF; Plgf; AI854365 |
| Description | Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF1, PlGF2 and PlGF3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR. |
| Protein Sequence | ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP |
| Uniprot ID | P49764 |
| Protein RefSeq | NP_032853 |
| mRNA RefSeq | NM_008827 |
Figures
SDS-PAGE analysis of recombinant mouse PlGF. Samples were loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and stained with Coomassie blue. Lane 1: MWM (kDa); lane 2/3: 2ug of recombinant mouse PlGF.
Functional ELISA for recombinant mouse PlGF produced in insect cells. A 96-well ELISA plate was coated with rmPlGF [100µl/well; 0,5µg/ml]. Increasing concentrations of recombinant human soluble sFlt-1 were added. Detection was performed using a biotinylated monoclonal anti-human VEGFR-1 antibody. As a control recombinant sKDR was used. There was no binding signal detectable.
Reference
- The Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR-1) D16F7 Monoclonal Antibody Inhibits Melanoma Adhesion to Soluble VEGFR-1 and Tissue Invasion in Response to Placenta Growth Factor. M. G. Atzori et al., Cancers (Basel). 2022 Nov; 14(22): 5578.
All prices plus VAT + possible delivery charges