Rabbit Prolactin
Slide this table
Cat-Nr. | 500-088S |
Size | 10 µg |
Price | 190 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
Length [aa] | 199 |
Molecular Weight | 23.0 kDa |
N Terminal Sequence | APICP |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinynt rbPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells and Baf3 cells stably transfected with rabbit prolactin receptor, algough its relative activity as compared to human prolactin is respectively 8-fold and 4-fold lower. Rabbit PRL forms also 1:1 complex with rabbit PRLR-ECD. |
Species Reactivity | Rabbit |
Reconstitution | It is recommended to reconstitute the lyophilized rbPRL in sterile 0.04% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
Description | Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data). |
Protein Sequence | APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Uniprot ID | Q28632 |
Protein RefSeq | NP_001076144.1 |
mRNA RefSeq | NM_001082675.1 |
All prices plus VAT + possible delivery charges