Ovine Prolactin antagonist (G129R)
Slide this table
| Cat-Nr. | 500-086S |
| Size | 10 µg |
| Price | 295 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 99% by SDS-PAGE & HPLC analyses |
| Length [aa] | 199 |
| Molecular Weight | 23.0 kDa |
| N Terminal Sequence | ATPVCP |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant oPRL G129R is devoid of agonistic activity and capable of inhibiting biological activity of oPRL or other lactogenic hormones as evidenced by proliferation assay of Nb2 or other cells. The truncated form is more potent inhibitor. |
| Species Reactivity | Ovine |
| Reconstitution | It is recommended to reconstitute the lyophilized oPRL G129R in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Description | Recombinant ovine prolactin, G129R mutein is one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (no published information). It is available in two forms: as full size protein and it its DEL 9 aa truncated form from its N-terminus which has higher inhibitory activity. |
| Protein Sequence | ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLERMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
| Uniprot ID | P01240 |
| Protein RefSeq | NP_001009306.1 |
| mRNA RefSeq | NM_001009306.1 |
All prices plus VAT + possible delivery charges