Chicken Prolactin, pegylated
Slide this table
| Cat-Nr. | 500-084 |
| Size | 50 µg |
| Price | 390 € |
| Source | E. coli |
| Label | PEG |
| Formulation | lyophilized |
| Purity Confirmation | > 99% by SDS-PAGE & HPLC analyses |
| Length [aa] | 199 |
| Molecular Weight | 39.0 kDa |
| N Terminal Sequence | ALPICP |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Pegylated chPRL is biologically active as evidenced by inducing proliferation of Nb2 cells or Baf/3 cells stably transfected with chPRL receptors, though its activity is lesser than hPRL. However it is anticipated that its activity in vivo will be higher than chPRL due to prolonged persistence in circulation. |
| Species Reactivity | Chicken |
| Reconstitution | It is recommended to reconstitute the lyophilized pegylated chPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Description | Recombinant chicken prolactin, consists of one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids was mono-pegylated and purified by proprietary chromatographic techniques as described by Oclon et al. (in press). Its molecular mass is ~ 39 kDa, however under non-denaturing conditions it behaves as 220 kDa protein due to its increased hydrodynamic volume. |
| Protein Sequence | ALPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC |
| Uniprot ID | P14676 |
| Protein RefSeq | NP_990797.2 |
| mRNA RefSeq | NM_205466.3 |
All prices plus VAT + possible delivery charges