Human Leptin super antagonist (mutant D23L/L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-044S |
Size | 50 µg |
Price | 190 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIQ |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Super human leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Super human leptin antagonist also inhibits various leptin effects in several in vitro bioassays. The inhibitory activity of super human leptin antagonist was increased 14 to 60 fold as measured by various criteria such as binding properties to human leptin binding domain (hLBD) and in vitro and in vivo bioassays. |
Species Reactivity | Human |
Reconstitution | It is recommended to reconstitute the lyophilized super human leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant super human leptin antagonist is one polypeptide chain containing 146 amino. Super human leptin antagonist (SHLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super human leptin antagonist that was purified by proprietary chromatographic techniques. More details can be found in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011). |
Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
Uniprot ID | P41159 |
Protein RefSeq | NP_000221.1 |
mRNA RefSeq | NM_000230 |
All prices plus VAT + possible delivery charges