Fish (denis) Growth Hormone
Slide this table
| Cat-Nr. | 500-020 |
| Size | 50 µg |
| Price | 295 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE. |
| Length [aa] | 188 |
| Molecular Weight | 21.4 kDa |
| N Terminal Sequence | AQPITDGQRL |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Binding assays of the 125I-labeled recombinant Gilthead Seabream growth hormone to dolphin fish liver microsomal fraction resulted in high specific binding characterized by a Ka of 1.93 nM and a Bmax of 540 fmol/mg microsomal fraction protein. Recombinant Gilthead Seabream growth hormone like ovine placental lactogen, exhibited growth-stimulating activity when applied orally to S.aurata larvae or intraperitoneally to juvenile fish. |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant Gilthead Seabream growth hormone in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Description | Recombinant Gilthead Seabream (Sparus aurata) growth hormone (gsGH) produced in E. coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of ~ 21.392 kDa. Recombinant Gilthead Seabream growth hormone was purified by chromatographic techniques, according to Ben-Atia et al., General and Comparative Endocrinology 113, 155–164 (1999). |
| Protein Sequence | AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKTGIHLLIRANEDGAEIFPDSSALQLAPYGNYYQSLGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
| Uniprot ID | P29971 |
| Protein RefSeq | AAB19750.2 |
| mRNA RefSeq | S54890.1 |
All prices plus VAT + possible delivery charges