Description / rat Podoplanin, soluble protein
More Information
Size | 5 µg |
---|---|
Source | E. coli |
Biological Activity | Testing in progress. |
N Terminal Sequence | GAIGALED |
Purity Confirmation | > 98% by SDS-PAGE |
Length [aa] | 120 |
Species Reactivity | Rat |
Formulation | lyophilized |
Buffer | 0.5X PBS |
Protein Sequence | GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLEHHHHHH |
Reconstitution | We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use. |
Stability and Storage | The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted sPodoplanin should be stored in working aliquots at -20°C. |
Synonyms | Pdpn; E11; Gp38; OTS-8; RTI40; T1-alpha |
Uniprot ID | Q64294 |
Protein RefSeq | NP_062231.1 |
mRNA RefSeq | NM_019358.1 |