Description / human PlGF-2 protein
More Information
Size | 2 µg |
---|---|
Source | Insect cells |
Biological Activity | Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-2 can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL. |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 152 |
Molecular Weight | ~45.0 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | 50mM acetic acid |
Protein Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
Reconstitution | Centrifuge vial prior to opening. The PlGF-2 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use |
Stability and Storage | The lyophilized human PIGF-2, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C |
Synonyms | PlGF; placental growth factor |
Uniprot ID | P49763 |
Protein RefSeq | NP_001193941.1 |
mRNA RefSeq | NM_001207012.1 |