Description / human PlGF-1/His protein
More Information
Size | 5 µg |
---|---|
Source | Insect cells |
Biological Activity | Testing in progress. |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 139 |
Molecular Weight | ~36.5 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | 50mM acetic acid |
Protein Sequence | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRTRHHHHHH |
Reconstitution | Centrifuge vial prior to opening. The PlGF-1 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use |
Stability and Storage | The lyophilized human PIGF-1, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. |
Synonyms | PlGF; placental growth factor |
Uniprot ID | P49763 |
Protein RefSeq | NP_001193941.1 |
mRNA RefSeq | NM_001207012.1 |