Description / mouse Lyve-1, soluble protein
More Information
Size | 20 µg |
---|---|
Source | Insect cells |
Biological Activity | Not tested so far! |
N Terminal Sequence | ADLVQDLS |
Purity Confirmation | > 95% by SDS-PAGE |
Length [aa] | 211 |
Molecular Weight | ~ 35.0 - 45.0 kDa |
Species Reactivity | Mouse |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH |
Reconstitution | The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
Synonyms | Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik |
Uniprot ID | Q8BHC0 |
Protein RefSeq | NP_444477 |
mRNA RefSeq | NM_053247 |