mouse Lyve-1, soluble protein Mouse 20 µg

In stock

Cat-Nr.
S01-026
Size
20 µg
  €134.00

Description / mouse Lyve-1, soluble protein

A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 – Gly228) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.

More Information

Size 20 µg
Source Insect cells
Biological Activity Not tested so far!
N Terminal Sequence ADLVQDLS
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 211
Molecular Weight ~ 35.0 - 45.0 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
Reconstitution The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
Synonyms Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik
Uniprot ID Q8BHC0
Protein RefSeq NP_444477
mRNA RefSeq NM_053247

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA50
€310.00

In stock

SKU: 103-PA50AG
€190.00

In stock

SKU: 103-PABi50
€275.00

In stock

SKU: 103-M130
€533.00

In stock

All prices plus VAT + possible delivery charges