Description / Leptin binding protein
Recombinant human leptin binding domain (hLBD), is one polypeptide chain containing 208 amino acids and an additional Ala at N-terminus acids. It consists of the cytokine binding domain of leptin receptor (amino acids 428-635 of human leptin receptor and having a molecular mass of ~ 24.5 kDa, It was purified by proprietary chromatographic techniques (see Sandowski et al. J. Biol. Chem. (2002) 277(48):46304-9.
More Information
Size | 50 µg |
---|---|
Source | E. coli |
Biological Activity | Recombinant human LBDL is fully biologically active as evidenced by high affinity binding of mammalian leptins at 1:1 molar ratio. |
N Terminal Sequence | AIDVNI |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 208 |
Molecular Weight | 24.5 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Protein Sequence | AIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMD |
Reconstitution | It is recommended to reconstitute the lyophilized hLBD in sterile water adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
Synonyms | Lep; ob; obese |
Uniprot ID | P48357 |
Protein RefSeq | NP_001003679.1 |
mRNA RefSeq | NM_001003679.3 |