Description / Leptin binding protein
Recombinant human leptin binding domain (hLBD), is one polypeptide chain containing 208 amino acids and an additional Ala at N-terminus acids. It consists of the cytokine binding domain of leptin receptor (amino acids 428-635 of human leptin receptor and having a molecular mass of ~ 24.5 kDa, It was purified by proprietary chromatographic techniques (see Sandowski et al. J. Biol. Chem. (2002) 277(48):46304-9.
More Information
| Size | 50 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant human LBDL is fully biologically active as evidenced by high affinity binding of mammalian leptins at 1:1 molar ratio. |
| N Terminal Sequence | AIDVNI |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 208 |
| Molecular Weight | 24.5 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | AIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMD |
| Reconstitution | It is recommended to reconstitute the lyophilized hLBD in sterile water adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | P48357 |
| Protein RefSeq | NP_001003679.1 |
| mRNA RefSeq | NM_001003679.3 |