Description / tilapia Leptin A protein
Full‐length cDNA encoding two leptin sequences (tLepA and tLepB) were identified in tilapia (Oreochromis niloticus). The cDNAs of tLepA and tLepB were 486 bp and 459 bp in length, encoding proteins of 161 aa and 152 aa, respectively. The tLepA‐ ‐expressing plasmid was transformed into E. coli and expressed as recombinant protein upon induction with nalidixic acid, found almost entirely in insoluble inclusion bodies (IBs). The protein was solubilized, refolded and purified to homogeneity by anion‐exchange chromatography. More information can be found in Shpilman et al. (2014) General and Comparative Endocrinology 270, 74-85.
More Information
| Size | 100 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Monomeric and dimeric Tilapia leptins were biologically active in promoting proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor (hLepR), but their activity was four orders of magnitude lower than that of mammalian l |
| N Terminal Sequence | APLPVE |
| Purity Confirmation | > 95.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 141 |
| Molecular Weight | 15.9 kDa |
| Species Reactivity | Tilapia |
| Formulation | lyophilized |
| Protein Sequence | APLPVEVVTMKSKVKWMAEQLVVRLDKDVQVPVNWTLNPPADDLDGTSSIETVLNGYNSLIPDTFKGVSQIKYDISSLTGYIHLWRQGHCSEQRPKPEVPGPLQELQSHKEFIQTVGIEALMRVKEFLNLLLKNLDQLETC |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant Tilapia leptin A in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Uniprot ID | I3KCE8 |
| Protein RefSeq | NP_001287979.1 |
| mRNA RefSeq | NM_001301050.1 |