IL-22 receptor antagonist (N54A) Mouse 10 µg

In stock

Cat-Nr.
500-031S
Size
10 µg
  €270.00

Description / IL-22 receptor antagonist (N54A)

IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 mutant N54A (numbering according to human IL-22 including signal peptide) produced in E.Coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. Preparation of recombinant mIL-22 antagonists provides new tools for the study of IL-22 activity and of eventual therapeutic means for attenuating its negative effects. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).

More Information

Size 10 µg
Source E. coli
Biological Activity Recombinant murine IL-22 N54A mutant is capable of full inhibition of STAT3 phosphorylation induced by mouse interleukin 22 in HepG cells. Its affinity toward immobilized mIL-22 receptor α1 extracellular domain (mIL-22 Rα1-ECD) or IL-22 binding protein is
N Terminal Sequence ALPVN
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 147
Molecular Weight 16.7 kDa
Species Reactivity Mouse
Formulation lyophilized
Protein Sequence ALPVNTRCKLEVSNFQQPYIVARTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Reconstitution It is recommended to reconstitute the lyophilized IL-22 N54A in sterile H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions containing carrier protein such as BSA, HSA or similar.
Synonyms IL22; IL-22; Iltif; IL-22a; ILTIFa
Uniprot ID Q9JJY9
Protein RefSeq NP_058667.1
mRNA RefSeq NM_016971

All prices plus VAT + possible delivery charges