rabbit Growth Hormone Receptor (hGH binding protein), soluble protein Rabbit 100 µg
Description / rabbit Growth Hormone Receptor (hGH binding protein), soluble protein
Recombinant rbGHBP, one polypeptide chain containing 248 amino acids and having a molecular mass of ~ 28 kDa, Rabbit GHBP was purified by proprietary chromatographic techniques, (see Sakal et al. Prep Biochem Biotechnol. 30:107-23, 2000).
More Information
Size | 100 µg |
---|---|
Source | E. coli |
Biological Activity | hGHBP is fully biologically active as evidenced by its ability of forming 2:1 complex with non-primate GHs. |
N Terminal Sequence | APSGS |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 248 |
Molecular Weight | 28.0 kDa |
Formulation | lyophilized |
Protein Sequence | AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRF |
Reconstitution | It is recommended to reconstitute the lyophilized rbGHBP in sterile 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Uniprot ID | P19941 |
Protein RefSeq | NP_001076105.1 |
mRNA RefSeq | NM_001082636.1 |