zebrafish Growth Hormone protein Zebrafish 10 µg
Description / zebrafish Growth Hormone protein
Recombinant zebrafish growth hormone (zbGH) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 185 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21187 Dalton.
More Information
Size | 10 µg |
---|---|
Source | E. coli |
Biological Activity | zfGH is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. |
N Terminal Sequence | AQRLFN |
Purity Confirmation | > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
Length [aa] | 186 |
Molecular Weight | 21.1 kDa |
Formulation | lyophilized |
Protein Sequence | AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNQITEKLADLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
Reconstitution | It is recommended to reconstitute the lyophilized zfGH mutant in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of car |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Uniprot ID | Q1JQ34 |
Protein RefSeq | NP_001018328.2 |
mRNA RefSeq | NM_001020492.2 |