rainbow trout Growth Hormone protein Rainbow trout 10 µg
Description / rainbow trout Growth Hormone protein
Recombinant rainbow trout growth hormone (rtGH) produced in E. coli (22 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21535 Dalton. rtGH is expressed as inclusion bodies, refolded and purified by proprietary chromatographic techniques.
More Information
| Size | 10 µg |
|---|---|
| Source | E. coli |
| Biological Activity | rtGH is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors, though its activity is ~ 10-fold lower than that of human GH. |
| N Terminal Sequence | AIENQR |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE. |
| Length [aa] | 188 |
| Molecular Weight | 22.0 kDa |
| Formulation | lyophilized |
| Protein Sequence | AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
| Reconstitution | It is recommended to reconstitute the lyophilized rtGH in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier pr |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Uniprot ID | P09538 |
| Protein RefSeq | NP_001118161.1 |
| mRNA RefSeq | NM_001124689.1 |