fish (denis) Growth Hormone protein Fish (denis) 10 µg
Description / fish (denis) Growth Hormone protein
Recombinant Gilthead Seabream (Sparus aurata) growth hormone (gsGH) produced in E. coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of ~ 21.392 kDa. Recombinant Gilthead Seabream growth hormone was purified by chromatographic techniques, according to Ben-Atia et al., General and Comparative Endocrinology 113, 155–164 (1999).
More Information
Size | 10 µg |
---|---|
Source | E. coli |
Biological Activity | Binding assays of the 125I-labeled recombinant Gilthead Seabream growth hormone to dolphin fish liver microsomal fraction resulted in high specific binding characterized by a Ka of 1.93 nM and a Bmax of 540 fmol/mg microsomal fraction protein. Recombinant |
N Terminal Sequence | AQPITDGQRL |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE. |
Length [aa] | 188 |
Molecular Weight | 21.4 kDa |
Formulation | lyophilized |
Protein Sequence | AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKTGIHLLIRANEDGAEIFPDSSALQLAPYGNYYQSLGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant Gilthead Seabream growth hormone in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Uniprot ID | P29971 |
Protein RefSeq | AAB19750.2 |
mRNA RefSeq | S54890.1 |