fish (carp) Growth Hormone protein Fish (carp) 10 µg
Description / fish (carp) Growth Hormone protein
Recombinant common carp (Cyprinus carpio) growth hormone (caGH) produced in E.Coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of 21404 Da. Recombinant common carp growth hormone is purified by chromatographic techniques, according to Fine et al. General and Comparative Endocrinology, 89,51-61 (1993).
More Information
Size | 10 µg |
---|---|
Source | E. coli |
Biological Activity | Recombinant common carp growth hormone is biologically active in rat 3T3 F442A preadipocytes, though its activity is 15-fold lower compared to bovine GH, but it is equally potent in vivo in promoting carp growth (Fine et al.1993). Recombinant common carp |
N Terminal Sequence | SDNQRLF |
Purity Confirmation | > 95.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
Length [aa] | 188 |
Molecular Weight | 21.4 kDa |
Formulation | lyophilized |
Protein Sequence | SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPAGKDETQKSSMLKLLRISFHLIESWEFPSQSLSGTVSNSLTVGNPNQLTEKLADLKMGISVLIQACLDGQPNMDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant common carp growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml. Recombinant common carp growth hormone can then be further dilut |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Uniprot ID | P10298 |
Protein RefSeq | XP_018951738.1 |
mRNA RefSeq | XM_019096193.2 |