Description / Growth Hormone
Recombinant rabbit growth hormone (rbGH), one polypeptide chain containing 190 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 21.5 kDa
More Information
Size | 10 µg |
---|---|
Source | E. coli |
Biological Activity | rbGH is fully biologically active as evidenced by inducing proliferation of FDC-P1 cells stably transfected with rabbit GH receptor. |
N Terminal Sequence | AFPAM |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 191 |
Molecular Weight | 21.5 kDa |
Formulation | lyophilized |
Protein Sequence | AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF |
Reconstitution | It is recommended to reconstitute the lyophilized rbGH in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Uniprot ID | P46407 |
Protein RefSeq | NP_001316004.1 |
mRNA RefSeq | NM_001329075.1 |