Growth Hormone Rabbit 50 µg

In stock

Cat-Nr.
500-015
Size
50 µg
  €304.00

Description / Growth Hormone

Recombinant rabbit growth hormone (rbGH), one polypeptide chain containing 190 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 21.5 kDa

More Information

Size 50 µg
Source E. coli
Biological Activity rbGH is fully biologically active as evidenced by inducing proliferation of FDC-P1 cells stably transfected with rabbit GH receptor.
N Terminal Sequence AFPAM
Purity Confirmation > 98.0% as determined by Gel filtration and SDS-PAGE gel.
Length [aa] 191
Molecular Weight 21.5 kDa
Formulation lyophilized
Protein Sequence AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF
Reconstitution It is recommended to reconstitute the lyophilized rbGH in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P46407
Protein RefSeq NP_001316004.1
mRNA RefSeq NM_001329075.1

All prices plus VAT + possible delivery charges