chicken Growth Hormone protein Chicken 10 µg

In stock

Cat-Nr.
500-010S
Size
10 µg
  €196.00

Description / chicken Growth Hormone protein

Chicken recombinant growth hormone (chGH) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-terminus and having a molecular mass of 22237 Dalton. For reference see Eliasiewicz et al. (2006) Ann N Y Acad Sci. 1091:501-508.

More Information

Size 10 µg
Source E. coli
Biological Activity Chicken recombinant growth hormone is fully biologically active in homologous assays and in PDF-P1 3B9 cells stably transfected with rabbit growth hormonr receptors.
N Terminal Sequence ATFPA
Purity Confirmation > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
Length [aa] 191
Molecular Weight 22.2 kDa
Formulation lyophilized
Protein Sequence ATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI
Reconstitution It is recommended to reconstitute the lyophilized chicken recombinant growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, prefer
Synonyms Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
Uniprot ID P08998
Protein RefSeq NP_989690.1
mRNA RefSeq NM_204359.2

All prices plus VAT + possible delivery charges