CD34, soluble Human 5 µg

In stock

Cat-Nr.
S01-069S
Size
5 µg
  €85.00

Description / CD34, soluble

CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein.

More Information

Size 5 µg
Source E. coli
Biological Activity Data not available.
N Terminal Sequence SLDNN
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 267
Molecular Weight 28.6 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSY
Synonyms CD34
Uniprot ID P28906
Protein RefSeq NP_001764.1
mRNA RefSeq NM_001773.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M94
€134.00

In stock

SKU: 102-PA139
€310.00

In stock

All prices plus VAT + possible delivery charges