Description / CD105/Endoglin, soluble
A cDNA sequence encoding the extracellular domain of human Endoglin (Met 1 - Leu 586) was expressed in insect cells. Human Endoglin is a disulfide-linked homodimeric protein. According to N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. Endoglin has a calculated monomeric molecular mass of 61 kDa but as a result of glycosylation, migrates at approximately 70 - 75 kDa under reducing conditions in SDS-PAGE. Endoglin, also known as CD105, is a Type I integral membrane glycoprotein with a large, disulfide-linked, extracellular region and a short, constitutively phosphorylated, cytoplasmic tail. Two splice variants of human Endoglin, the S-Endoglin and L-Endoglin that differ in the length of their cytoplasmic tails have been identified. Endoglin is highly expressed on vascular endothelial cells, chondrocytes, and syncytiotrophoblasts of term placenta. It is also found on activated monocytes, bone marrow pro-erythroblasts, and leukemic cells of lymphoid and myeloid lineages. Human and mouse Endoglin share approximately 70% and 97 % amino acid sequence identity in their extracellular and intracellular domains, respectively. Endoglin has been shown to be a powerful marker of neovascularization. It is also useful as a functional marker that defines long-term repopulating hematopoietic stem cells.
More Information
Size | 5 µg |
---|---|
Source | Insect cells |
Biological Activity | Testing in Progress. |
Purity Confirmation | > 90% by SDS-PAGE |
Length [aa] | 565 |
Molecular Weight | 70-75 kDa |
Species Reactivity | Human |
Formulation | lyophilized |
Buffer | PBS |
Protein Sequence | ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK |
Reconstitution | The lyophilized sCD105 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml. |
Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sCD105 should be stored in working aliquots at -20°C. |
Synonyms | Endoglin; END; ORW; HHT1; ORW1; CD105 |
Uniprot ID | P17813 |
Protein RefSeq | NP_000109 |
mRNA RefSeq | NM_000118 |