Human Prolactin Receptor, soluble
Slide this table
| Cat-Nr. | 500-081S |
| Size | 50 µg |
| Price | 390 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 97% by SDS-PAGE & HPLC analyses |
| Length [aa] | 210 |
| Molecular Weight | 23.9 kDa |
| N Terminal Sequence | AGKPEI |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Activity is determined by the dose-dependant inhibition of PRL-stimuled proliferation of Nb2 cells and by high affinity binding of PRL and other lactogenic hormones in 1:1 molar ratio. |
| Species Reactivity | Rat, Human |
| Reconstitution | It is recommended to reconstitute the lyophilized PRLR-ECD in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Description | Prolactin is a pituitary hormone involved in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The initial step in its action is the binding to a specific membrane receptor (prolactin receptor) which belongs to the superfamily of class 1 cytokine receptors. Prolactin (PRL) is a hormone involved in a variety of important functions including ion transport and osmoregulation, stimulation of milk, protein synthesis as well as the regulation of numerous reproductive functions. PRL exerts its influence on different cell types through a signal transduction pathway which begins with the binding of the hormone to a transmembrane PRL receptor. PRL receptor, varies in size (short and long forms) with tissue source and species, from ~40 kDa to 100 kDa. The PRL receptor consists of at least three separate domains: an extracellular region with 5 cysteines which contains the prolactin binding site, a single transmembrane domain and a cytoplasmic region, the length of which appears to influence ligand binding and regulate cellular function. Recombinant human Prolactin Receptor Extra Cellular Domain (rbPRLR-ECD) produced in E.Coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23972 Da was prepared like the rabbit PRLR-ECD according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91. |
| Protein Sequence | AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTV |
| Uniprot ID | P16471 |
| Protein RefSeq | NP_000940.1 |
| mRNA RefSeq | NM_000949.7 |
All prices plus VAT + possible delivery charges