Rat VEGF120
Slide this table
| Cat-Nr. | R20-063 |
| Size | 5 µg |
| Price | 135 € |
| Source | E. coli |
| Formulation | lyophilized (freeze-dried) |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 120 |
| Molecular Weight | 14.02 kDa |
| N Terminal Sequence | APTTEGEQKAH |
| Biological Activity | Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml. |
| Species Reactivity | Rat |
| Buffer | PBS |
| Reconstitution | The lyophilized VEGF120 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml. |
| Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF120 should be stored in working aliquots at -20°C. |
| Synonyms | Vascular Endothelial Growth Factor A; Vegfa; Vegf; VEGF120 |
| Description | Rat Vascular Endothelial Growth Factor120 (VEGF120), a 14.1 kDa protein consisting of 120 amino acid residues, is produced as a homodimer. VEGF120 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF120 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF120 (Ala27-Arg146) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols. |
| Protein Sequence | APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Uniprot ID | P16612 |
| Protein RefSeq | NP_114024.2. |
| mRNA RefSeq | NM_031836.2 |
Figures
SDS-PAGE analysis of recombinant rat VEGF120. Sample was loaded in 15% SDS-polyacrylamide gel under non-reducing conditions and visualized with Silver stain.
Dose-dependent stimulation of cell proliferation in primary human umbilical vein endothelial cells (HUVEC) by recombinant rat VEGF120. Values are the means (±SD) of triplicate determinations and expressed as percentage of control.
All prices plus VAT + possible delivery charges