Mouse IP-10 (CXCL10)
Slide this table
| Cat-Nr. | M10-025 |
| Size | 25 µg |
| Price | 199 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 77 |
| Molecular Weight | 8.7 kDa |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml. |
| Species Reactivity | Human, Mouse, Rat, Monkey |
| Synonyms | Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10 |
| Description | Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues. |
| Protein Sequence | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP |
| Uniprot ID | P17515 |
| Protein RefSeq | NP_067249.1 |
| mRNA RefSeq | NM_021274.2 |
All prices plus VAT + possible delivery charges