Pufferfish Leptin
Slide this table
| Cat-Nr. | 500-071 |
| Size | 500 µg |
| Price | 510 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 134 |
| Molecular Weight | 15.3 kDa (momnomer) |
| N Terminal Sequence | ALPGA |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant fish leptin is capable of inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins. |
| Species Reactivity | Pufferfish |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant fish leptin in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | The first biologically active recombinant fish leptin was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al , General and Comparative Endocrinology (2008) 156(1):83-90. |
| Protein Sequence | ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVEGSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQEQQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC |
| Uniprot ID | Q588G0 |
| Protein RefSeq | NP_001027897.1 |
| mRNA RefSeq | NM_001032725.1 |
All prices plus VAT + possible delivery charges