Ovine Leptin super antagonist (mutant D23L/L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-068S |
Size | 50 µg |
Price | 190 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIR |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant super active ovine leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. The inhibitory activity of recombinant super active ovine leptin antagonist was increased 14 to 60 fold as measured by various criteria such as binding properties to human leptin binding domain (hLBD) and in vitro bioassays as compared to recombinant ovine leptin antagonist. |
Species Reactivity | Ovine |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant super active ovine leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, was mutated, resulting in D23L/L39A/D40A/F41A mutant termed recombinant super active ovine leptin antagonist that was purified by proprietary chromatographic techniques. |
Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINLISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
Protein RefSeq | XP_027824581.2 |
mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges