Ovine Leptin antagonist (mutant L39A/D40A/F41A/I42A)
Slide this table
| Cat-Nr. | 500-067S |
| Size | 50 µg |
| Price | 175 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 16.0 kDa |
| N Terminal Sequence | AVPIR |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Ovine recombinant leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of ovine leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. |
| Species Reactivity | Ovine |
| Reconstitution | It is recommended to reconstitute the lyophilized ovine recombinant leptin antagonist in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, ovine leptin was mutated, resulting in L39A/D40A/F41A/I42A mutant was purified by proprietary chromatographic techniques. Preparation of leptin antagonists was published - Niv-Spector et al, Biochem. J 291;221-230 (2005). |
| Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
| Protein RefSeq | XP_027824581.2 |
| mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges