Ovine Leptin pegylated antagonist (mutant L39A/D40A/F41A)
Slide this table
| Cat-Nr. | 500-066S |
| Size | 50 µg |
| Price | 295 € |
| Source | E. coli |
| Label | PEG |
| Formulation | lyophilized |
| Purity Confirmation | > 95.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 35.6 kDa |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant ovine pegylated leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. Its in vitro activity is 6-8 fold lower than the non-pegylated antagonist but in vivo it has profound weight gain effect (as compared to the non-pegylated antagonist like in mouse leptin antagonists), resulting mainly from increased food intake. |
| Species Reactivity | Ovine |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant ovine pegylated leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Mono-pegylated (with 20 kDa PEG)recombinant ovine leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Ovine leptin was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Niv-Spector et al (2005) Biochemical Journal, 291, 221-230 and its pegylation was similar to that of mouse leptin antagonist is described in Elinav et al. Endocrinology (2009)150, 3083-3091. |
| Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
| Protein RefSeq | XP_027824581.2 |
| mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges