Ovine Leptin, MTS-tagged
Slide this table
Cat-Nr. | 500-063 |
Size | 500 µg |
Price | 510 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 157 |
Molecular Weight | 17.5 kDa |
N Terminal Sequence | AAVLLP |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | MTS-ovine recombinant leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. In vivo experiments has shown potency equal but not higher that non tagged ovine leptin (A. Gertler, unpublished data). |
Species Reactivity | Ovine |
Reconstitution | It is recommended to reconstitute the lyophilized MTS-ovine recombinant leptin in sterile 0.4% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant ovine MTS-leptin, one polypeptide chain containing 157 amino and (extra 10 amino acids of the membrane translocating sequence Val-Leu-Leu-Pro-Val-Leu-Leu-Ala-Ala-Pro) derived from Kaposi virus and additional Ala at N-terminus acids . The resulting molecular mass of is ~ 17.5 kDa, MTS-ovine leptin was purified by proprietary chromatographic techniques. |
Protein Sequence | AAVLLPVLLAAPVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG |
Protein RefSeq | XP_027824581.2 |
mRNA RefSeq | XM_027968780.2 |
All prices plus VAT + possible delivery charges