Horse Leptin
Slide this table
Cat-Nr. | 500-061 |
Size | 500 µg |
Price | 510 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 99.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIR |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant horse leptin is fully biologically active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. |
Species Reactivity | Horse |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant horse leptin in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant horse leptin is an one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant horse leptin was purified by proprietary chromatographic techniques, (unpublished). |
Protein Sequence | AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARGLETLASLGGVLEASLYSTEVVALSRLQGSLQDMLQQLDLSPGC |
Uniprot ID | A0A3Q2L864 |
Protein RefSeq | NP_001157452.1 |
mRNA RefSeq | NM_001163980.1 |
All prices plus VAT + possible delivery charges