Rat Leptin antagonist (mutant L39A/D40A/F41A)
Slide this table
Cat-Nr. | 500-053 |
Size | 100 µg |
Price | 210 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 146 |
Molecular Weight | 16.0 kDa |
N Terminal Sequence | AVPIQ |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant rat leptin antagonist is capable of inhibiting leptin-induced proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. It also inhibits various leptin effects in several in vitro bioassays. |
Species Reactivity | Rat |
Reconstitution | It is recommended to reconstitute the lyophilized recombinant rat leptin antagonist in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
Synonyms | Lep; ob; obese |
Description | Recombinant rat leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant rat leptin was mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques, according to Salomon et al (2006) Protein Expression and PuriWcation 47, 128–136. |
Protein Sequence | AVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
Uniprot ID | P50596 |
Protein RefSeq | NP_037208 |
mRNA RefSeq | NM_013076 |
All prices plus VAT + possible delivery charges