Human Leptin N82K mutant, pegylated
Slide this table
| Cat-Nr. | 500-040S |
| Size | 100 µg |
| Price | 295 € |
| Source | E. coli |
| Label | PEG |
| Formulation | lyophilized |
| Purity Confirmation | > 99.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 146 |
| Molecular Weight | 35.6 kDa |
| N Terminal Sequence | AVPIQ |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant pegylated human leptin N82K mutant is less than 0.1% active active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. This abolishment of activity results from drastically reduced affinity toward leptin receptor. |
| Species Reactivity | Human |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant human pegylated leptin N82K mutant in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | Lep; ob; obese |
| Description | Mono-pegylated (with 20 kDa PEG) recombinant human leptin N82K mutant is an one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume recombinant human pegylated leptin runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Recombinant human pegylated leptin N82K mutant's half-life in circulation after SC injection was over 20 hours. Recombinant human leptin N82K mutant was purified by proprietary chromatographic techniques according to Salomon et al (2006) Protein Expression and Purification 47, 128–136 and then pegylated. |
| Protein Sequence | AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLEKLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Uniprot ID | P41159 |
| Protein RefSeq | NP_000221.1 |
| mRNA RefSeq | NM_000230 |
All prices plus VAT + possible delivery charges