Mouse IL-22 receptor antagonist (Y51A)
Slide this table
Cat-Nr. | 500-030 |
Size | 50 µg |
Price | 580 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
Length [aa] | 147 |
Molecular Weight | 16.7 kDa |
N Terminal Sequence | ALPVN |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | Recombinant murine IL-22 Y51A mutant is capable of full inhibition of STAT3 phosphorylation induced by mouse interleukin 22 in HepG cells. Its affinity toward immobilized mIL-22 receptor α1 extracellular domain (mIL-22 Rα1-ECD) or IL-22 binding protein is similar to the non mutated mouse interleukin 22. Mouse IL-22 antagonist (Y51A) has no agonistic activity in this bioassay. |
Species Reactivity | Mouse |
Reconstitution | It is recommended to reconstitute the lyophilized IL-22 Y51A in sterile H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions containing carrier protein such as BSA, HSA or similar. |
Synonyms | IL22; IL-22; Iltif; IL-22a; ILTIFa |
Description | IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 mutant Y51A (numbering according to human IL-22 including signal peptide) produced in E.Coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. Preparation of recombinant mIL-22 antagonists provides new tools for the study of IL-22 activity and of eventual therapeutic means for attenuating its negative effects. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012). |
Protein Sequence | ALPVNTRCKLEVSNFQQPAIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
Uniprot ID | Q9JJY9 |
Protein RefSeq | NP_058667.1 |
mRNA RefSeq | NM_016971 |
All prices plus VAT + possible delivery charges