Human IL-22, pegylated
Slide this table
| Cat-Nr. | 500-026 |
| Size | 50 µg |
| Price | 950 € |
| Source | E. coli |
| Label | PEG |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by Gel filtration and SDS-PAGE gel. |
| Length [aa] | 147 |
| Molecular Weight | 36.0 kDa (monomer) |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinantr human IL-22 is biologically active when compared to standard using STAT3 phosphorylation assay in HepG2 cells. Its activity in vitro is ~ 10% compared to the non-pegylated mIL22. |
| Species Reactivity | Human |
| Reconstitution | It is recommended to reconstitute the lyophilized pegylated mouse IL22 in sterile water or sterile 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted with other aqueous solutions. |
| Synonyms | I-TIF |
| Description | Mono-pegylated (with 20 kDa PEG)recombinant human interleukin 22 is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. It was prepared similarly to that described by L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012). |
| Protein Sequence | AAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Uniprot ID | Q9GZX6 |
| Protein RefSeq | NP_065386.1 |
| mRNA RefSeq | NM_020525.4 |
All prices plus VAT + possible delivery charges