Fish (carp) Growth Hormone
Slide this table
| Cat-Nr. | 500-019 |
| Size | 50 µg |
| Price | 295 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 95.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
| Length [aa] | 188 |
| Molecular Weight | 21.4 kDa |
| N Terminal Sequence | SDNQRLF |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Recombinant common carp growth hormone is biologically active in rat 3T3 F442A preadipocytes, though its activity is 15-fold lower compared to bovine GH, but it is equally potent in vivo in promoting carp growth (Fine et al.1993). Recombinant common carp growth hormone is capable to form a 1:2 complex with oGHR-ECD and induce proliferation of PFD-P1 cells stably transfected with rabbit growth hormone receptor, though its activity is 5-fold lower compared to bovine GH (A. Gertler, unpublished data). |
| Reconstitution | It is recommended to reconstitute the lyophilized recombinant common carp growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml. Recombinant common carp growth hormone can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Description | Recombinant common carp (Cyprinus carpio) growth hormone (caGH) produced in E.Coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of 21404 Da. Recombinant common carp growth hormone is purified by chromatographic techniques, according to Fine et al. General and Comparative Endocrinology, 89,51-61 (1993). |
| Protein Sequence | SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPAGKDETQKSSMLKLLRISFHLIESWEFPSQSLSGTVSNSLTVGNPNQLTEKLADLKMGISVLIQACLDGQPNMDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Uniprot ID | P10298 |
| Protein RefSeq | XP_018951738.1 |
| mRNA RefSeq | XM_019096193.2 |
All prices plus VAT + possible delivery charges