Ovine Growth Hormone antagonist (G119R)
Slide this table
Cat-Nr. | 500-013 |
Size | 50 µg |
Price | 295 € |
Source | E. coli |
Formulation | lyophilized |
Purity Confirmation | > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
Length [aa] | 191 |
Molecular Weight | 22.0 kDA |
N Terminal Sequence | ATFPA |
Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
Biological Activity | oGH G119R acts as antagonist using an in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. It is capable of forming a 1:1 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD) and binds to this ECD with affinity similar to the wild type oGH. |
Reconstitution | It is recommended to reconstitute the lyophilized oGH G119R in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar. |
Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
Description | Recombinant ovine GH-22K G119R produced in E. coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids and having a molecular mass of 22 kDa. It is mutated in single amino acid (G119R) according to similar bovine GH mutein described by Chen et al. (1991), Molecular Endocrinology 5:1845–1852. |
Protein Sequence | AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEERILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
Uniprot ID | P67930 |
Protein RefSeq | NP_001009315.2 |
mRNA RefSeq | NM_001009315.3 |
All prices plus VAT + possible delivery charges