Chicken Growth Hormone mutant (G119R)
Slide this table
| Cat-Nr. | 500-011 |
| Size | 50 µg |
| Price | 295 € |
| Source | E. coli |
| Formulation | lyophilized |
| Purity Confirmation | > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel. |
| Length [aa] | 191 |
| Molecular Weight | 22.3 kDa |
| N Terminal Sequence | ATFPA |
| Endotoxin Levels | < 0.1 ng/µg of protein (<1EU/µg) |
| Biological Activity | Chicken recombinant growth hormone G119R mutant did not bind to ovine growth hormone extracellular domain (ECD) and was devoid of any biological activity in FDC-P1 3B9 cells. However, in binding experiments that were carried out using chicken liver membranes, both ovine growth hormone and chicken recombinant growth hormone showed similar IC50 values in competition with 125I-oGH, while the IC50 of chicken recombinant chicken growth hormone G119R mutein was 10-fold higher. These results emphasize the importance of species specificity and indicate the possibility of antagonistic activity of chicken recombinant growth hormone G119R in homologous system. |
| Reconstitution | It is recommended to reconstitute the lyophilized chicken recombinant growth hormone in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml and not more than 3 mg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone |
| Description | Chicken recombinant growth hormone (chGH) mutein G119R produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-terminus and having a molecular mass of 22.3 kDa. For reference see Eliasiewicz et al. (2006) Ann N Y Acad Sci. 1091:501-508. |
| Protein Sequence | ATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEERIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI |
| Uniprot ID | P08998 |
| Protein RefSeq | NP_989690.1 |
| mRNA RefSeq | NM_204359.2 |
All prices plus VAT + possible delivery charges